Build momentum across programming, AI, cybersecurity, finance, Linux, crypto, entrepreneurship, and informatics with fast lessons and a free mini-game.
no sale observed
This is the largest amount Spy has ever observed on Bitwise’s own public pages. Read it as a floor. It is not revenue and it is not profit, and money taken before Spy started reading is not in it.
1,260 filed beside it17 ever paidSecurity and privacy
The 3 businesses on this ground with the most money observed. Open any of them and read its file. What each one charges, what it promises and how it asks for the money is what the audit reads.
The audit of Bitwise
Everything above is free and counted. The audit is written: the market it sells into, the buyer who pays, the 3 beliefs blocking that sale, what its 5 nearest rivals charge and promise, the offer that would take the ground, and the one move to make in 24 hours.
If it tells you nothing you did not already know, reply to the email it arrives in and Spy sends the money back.
The free audit is the whole file on CVBoost, written the same way, with nothing removed. Read it before deciding whether this one is worth $9.
2 ads observednone running nowon Meta
stoppedstarted 23 Jul 2026 · ended 27 Jul 2026Meta
Level Up Your Skills, a Few Minutes a Day
ACE Academy is the gamified micro-learning platform that lets you master coding, AI, cybersecurity, finance, and more, one bite-sized lesson at a time. Earn XP, climb leaderboards, and build real cross-domain expertise. Try a free lesson now, no sign-up needed.
https://bitwise.nanocorp.app/?utm_source=facebook&utm_medium=paid_social&utm_campaign=6bb4d116-9759-448f-ba17-1cf389491576
stoppedstarted 21 Jul 2026 · ended 24 Jul 2026Meta
Level Up Your Skills, a Few Min a Day
ACE Academy is the gamified micro-learning platform for polymaths. Master Tech, AI, Finance, Crypto, Cybersecurity & more, one quick lesson at a time, with streaks, XP, and leaderboards to keep you hooked. Try a free coding mini-game instantly, no signup needed.
https://bitwise.nanocorp.app/?utm_source=facebook&utm_medium=paid_social&utm_campaign=6bb4d116-9759-448f-ba17-1cf389491576
Read from Meta’s public ad library. It publishes what an ad said, when it ran and where it pointed. It publishes what an ad cost for political and issue ads only, so no amount spent appears here and Spy does not estimate one. Reach is reported in the EU and the UK alone.
bitwiseaceacademylevelskillsfewminutesdaybuildmomentumacrossprogrammingcybersecurityfinance
Pulled from the words on Bitwise’s own page. They are what the ground above was derived from.
